PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009621190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 369aa    MW: 42148.6 Da    PI: 7.6568
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009621190.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W+  + + g+ R++ +c++rw +yl
   XP_009621190.1 14 KGPWTPEEDQKLLAYIEEHGCGSWSDLPPKAGLQRCGRSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding46.49.4e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eE+  +++++++lG++ W++Ia+ ++ +R+++ +k++w++
   XP_009621190.1  67 RGKFSSEEERTILQLHALLGNR-WSAIASLLP-NRSDNVVKNYWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.964961IPR017930Myb domain
SuperFamilySSF466891.37E-2912108IPR009057Homeodomain-like
SMARTSM007171.1E-111363IPR001005SANT/Myb domain
PfamPF002498.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-241568IPR009057Homeodomain-like
CDDcd001671.20E-91661No hitNo description
PROSITE profilePS5129423.76962116IPR017930Myb domain
SMARTSM007171.4E-1466114IPR001005SANT/Myb domain
PfamPF002495.0E-1467110IPR001005SANT/Myb domain
CDDcd001673.53E-969112No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2469117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGRLPCIDKK GFKKGPWTPE EDQKLLAYIE EHGCGSWSDL PPKAGLQRCG RSCRLRWINY  60
LRPNIKRGKF SSEEERTILQ LHALLGNRWS AIASLLPNRS DNVVKNYWNT RLKKRLIKMG  120
IDPMTHQPKR DTSQSNKSIA SLSHMAEWET ARLEAEARLV RNSNKARSRA SVVSHFGNKP  180
LSTHIFSAWS TLESYASRMV SNNCVAVNST TYNNNNNYQP RNFQLPCLDI LKAWQMSCTK  240
LPTLNDDINR ATFLDGFFNK NLKSPTPSEN LLNIEQTVEV GEQLSLPTIS CIEEFFLHED  300
KITQDNDILQ TDLTELFPEY DCSQTAENYP GELLESFWES CSGDFENNKS NCNNHFPYLV  360
TSPIGSPLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-291411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621190.10.0PREDICTED: transcription factor MYB34-like
TrEMBLM0ZSU01e-129M0ZSU0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000073361e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.18e-87myb domain protein 16